PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000188G1020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family NF-YA
Protein Properties Length: 194aa    MW: 20935.5 Da    PI: 6.651
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000188G1020genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA50.28.3e-16157192137
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkp 37 
                      +ep+YVN KQy++Il+RRq Rakle+e+kl  ksrk 
  PH01000188G1020 157 EEPIYVNGKQYHAILRRRQLRAKLEAENKL-VKSRKS 192
                      69****************************.999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.0E-5155193IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115221.034156193IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-11158191IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGTCSLDPFS SHRCYCGSCV WLVCGKGASE SYNTYCVPLA ENGTIMIQFG HQMPDYDSSA  60
TQSTSESPQE VSGMSEGSLN GQNDQSGNLD GYTKSDEGKP VSYARCLPFQ AISYPYADSF  120
YGGTVAAYGS HAIMHPPIVG MVSSSRVPLP IEPAAAEEPI YVNGKQYHAI LRRRQLRAKL  180
EAENKLVKSR KSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3553721e-75AK355372.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1019N07.
GenBankAK3605281e-75AK360528.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1119O03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631822.14e-83PREDICTED: nuclear transcription factor Y subunit A-7
TrEMBLA0A0D9VQ495e-88A0A0D9VQ49_9ORYZ; Uncharacterized protein
STRINGORGLA03G0053200.12e-84(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.16e-23nuclear factor Y, subunit A6